PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe7G172600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 1051aa    MW: 115531 Da    PI: 4.813
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe7G172600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.74.8e-174692148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g WT+eEd ll +av+++ g++Wk+Ia+++   Rt+ qc +rwqk+l
  Aqcoe7G172600.1.p 46 KGQWTAEEDALLCRAVQRFQGKNWKKIAECFK-ERTDVQCLHRWQKVL 92
                       799****************************9.************986 PP

2Myb_DNA-binding60.24.4e-1998144148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        +g+W++eEd+++v+ vk++G + W+tIa+ ++ gR +kqc++rw+++l
  Aqcoe7G172600.1.p  98 KGPWSKEEDDIIVEMVKKYGAKKWSTIAQALP-GRIGKQCRERWHNHL 144
                        79******************************.*************97 PP

3Myb_DNA-binding48.91.5e-15150192145
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                        +++WT+eE++ l++a++++G++ W+   + ++ gRt++ +k++w+
  Aqcoe7G172600.1.p 150 KDAWTQEEELTLIRAHQLYGNK-WAELTKFLP-GRTDNAIKNHWN 192
                        679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.4354192IPR017930Myb domain
SuperFamilySSF466891.66E-1844107IPR009057Homeodomain-like
SMARTSM007173.7E-144594IPR001005SANT/Myb domain
PfamPF002492.6E-144692IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-2248108IPR009057Homeodomain-like
CDDcd001677.38E-134992No hitNo description
PROSITE profilePS5129431.73393148IPR017930Myb domain
SuperFamilySSF466892.16E-3195191IPR009057Homeodomain-like
SMARTSM007174.6E-1897146IPR001005SANT/Myb domain
CDDcd001677.84E-16100144No hitNo description
PfamPF139211.2E-17101159No hitNo description
Gene3DG3DSA:1.10.10.601.2E-26109152IPR009057Homeodomain-like
PROSITE profilePS5129419.289149199IPR017930Myb domain
SMARTSM007171.1E-14149197IPR001005SANT/Myb domain
CDDcd001672.84E-11152192No hitNo description
Gene3DG3DSA:1.10.10.603.6E-21153199IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 1051 aa     Download sequence    Send to blast
MKSNRTKGTR GAEVPATAPS DGGDDGFQIM QPTHGRTCGP TRRSTKGQWT AEEDALLCRA  60
VQRFQGKNWK KIAECFKERT DVQCLHRWQK VLNPELVKGP WSKEEDDIIV EMVKKYGAKK  120
WSTIAQALPG RIGKQCRERW HNHLNPAINK DAWTQEEELT LIRAHQLYGN KWAELTKFLP  180
GRTDNAIKNH WNSSVKKKLD SYLTSGLLAQ FQALPNVGNP AICNSSSSRM QQSSRDNSSL  240
QDASETEEVS ECSQSSTLAG CSQIDCGMPN AVTVHTREEL KHSEEDIYRN GQNCSSSSCP  300
KEFYEVAYMV PDVSRGATNS ANSCEQNQSY EAGCSGSDER SLFESHELPN SSALELVHES  360
SGVHETSRRC EVGPDENQGS MSALLQSSLS FNCSTSMGTG MQNEKQELLH ISEDDCCGDA  420
PSESGMCYPL GNMSQCLGFN NMDGYMGSLV CQSESQRCET AGMLASNSYN RLQCADVFGN  480
SSCQTTFPHP PLVSSNEAKV MFDGEYDQVR DMCDGTQNLE HIPNPCERFA YPCDSIPRSD  540
DNLENVSVAL EPDPANDASN SNLLENFGSV SLNAERIVCS AGENTPLKTE QQDSEALFYE  600
PPRFPSLELP FFSCDLISSG GDLQQAYSPL GIRQLMMPTM NSLWDSPSRD DSPDFFLKSA  660
AKSFICTPSI LKKRQRELLS PVQERKSDKK HERDTSQGLY RTSMGIQNDS LDAIFNEKGT  720
CTASISSLEG ALLSPTSQLK KNSGVSDKEN FDNGKQSLAN VDALAKVDGD SAMPMVQRSS  780
GVLIEQDVNA LQFFSPDRDK YPSNRILNIG ATTPRDLYLR DVALSRGGPS GCSESSLWTL  840
HISPKNAKGK HDIDSVPVYS VQYDPSSLTH QSTSENAGNN VEFESYSLYG DTPLLKRGIE  900
SPSAWKSPWF ANSFLPGPRI DTDITIEDIG YLMSPGDGSY DALALMRQLG EQSAAALAEA  960
QEVLASESPD YSLKEQYSDQ NHVAKENNLY PMNDPQNHKP LPSDLLNERR VLDFSGCETP  1020
RKGSESTKSS GSASAGRFSS STSYLMKGCR *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-65461996159MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-65461996159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00466DAPTransfer from AT4G32730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010254092.10.0PREDICTED: myb-related protein 3R-1-like isoform X2
TrEMBLA0A061GRG00.0A0A061GRG0_THECC; Myb domain protein 3r-4, putative
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.11e-106Homeodomain-like protein